Lineage for d6okga2 (6okg A:252-412)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2524952Species Escherichia coli [TaxId:83333] [277961] (5 PDB entries)
  8. 2524978Domain d6okga2: 6okg A:252-412 [384136]
    Other proteins in same PDB: d6okgb_
    automated match to d3o04a2
    complexed with mu4, na

Details for d6okga2

PDB Entry: 6okg (more details), 2.3 Å

PDB Description: crosslinked crystal structure of type ii fatty acid synthase ketosynthase, fabf, and c16-crypto acyl carrier protein, acpp
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d6okga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6okga2 c.95.1.0 (A:252-412) automated matches {Escherichia coli [TaxId: 83333]}
kiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvnahgtstpagd
kaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqavpptinldnp
degcdldfvphearqvsgmeytlcnsfgfggtngslifkki

SCOPe Domain Coordinates for d6okga2:

Click to download the PDB-style file with coordinates for d6okga2.
(The format of our PDB-style files is described here.)

Timeline for d6okga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6okga1
View in 3D
Domains from other chains:
(mouse over for more information)
d6okgb_