Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Escherichia coli [TaxId:83333] [277961] (5 PDB entries) |
Domain d6okga2: 6okg A:252-412 [384136] Other proteins in same PDB: d6okgb_ automated match to d3o04a2 complexed with mu4, na |
PDB Entry: 6okg (more details), 2.3 Å
SCOPe Domain Sequences for d6okga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6okga2 c.95.1.0 (A:252-412) automated matches {Escherichia coli [TaxId: 83333]} kiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvnahgtstpagd kaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqavpptinldnp degcdldfvphearqvsgmeytlcnsfgfggtngslifkki
Timeline for d6okga2: