SCOPe 2.07: Domain d6omgd2: 6omg D:113-240

Lineage for d6omgd2 (6omg D:113-240)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6omgd2: 6omg D:113-240 [384117]
   Other proteins in same PDB: d6omga1, d6omgb_, d6omgc2
   automated match to d3q5ya2
   complexed with fuc, gol, mvv, na, nag

Details for d6omgd2

PDB Entry: 6omg, 2.1 Å

PDB Description: structure of mouse cd1d- glc-dag (sn-1 c18:0, sn-2 c18:1c9)-inkt tcr ternary complex

PDB Compounds: (D:) Chimeric T cell antigen receptor beta chain Vb8.2, vb11

SCOPe Domain Sequences for d6omgd2:

Sequence; same for both SEQRES and ATOM records:

>d6omgd2 b.1.1.0 (D:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d6omgd2:

• d6omgd2 is new in SCOPe 2.07-stable
  
• d6omgd2 appears in the current release, SCOPe 2.08