SCOP 1.73: Domain d1qpfa_: 1qpf A:

Lineage for d1qpfa_ (1qpf A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (3 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)

6. Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
   cis-trans prolyl-isomerase

7. Species Human (Homo sapiens) [TaxId:9606] [54537] (32 PDB entries)

8. Domain d1qpfa_: 1qpf A: [38411]

Details for d1qpfa_

PDB Entry: 1qpf, 2.5 Å

PDB Description: fk506 binding protein (12 kda, human) complex with l-709,858

PDB Compounds: (A:) protein (fk506-binding protein)

SCOP Domain Sequences for d1qpfa_:

Sequence; same for both SEQRES and ATOM records:

>d1qpfa_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d1qpfa_:

• d1qpfa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qpfa_ appears in SCOP 1.71
  
• d1qpfa_ appears in SCOP 1.75
  
• d1qpfa_ appears in the current release, SCOPe 2.08