Lineage for d4fapa_ (4fap A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1022608Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1022609Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1022610Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1022621Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 1022625Species Human (Homo sapiens) [TaxId:9606] [54537] (39 PDB entries)
  8. 1022665Domain d4fapa_: 4fap A: [38409]
    Other proteins in same PDB: d4fapb_
    complexed with ard

Details for d4fapa_

PDB Entry: 4fap (more details), 2.8 Å

PDB Description: atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
PDB Compounds: (A:) fk506-binding protein

SCOPe Domain Sequences for d4fapa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fapa_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOPe Domain Coordinates for d4fapa_:

Click to download the PDB-style file with coordinates for d4fapa_.
(The format of our PDB-style files is described here.)

Timeline for d4fapa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4fapb_