SCOPe 2.08: Domain d6pc4b1: 6pc4 B:2-243

Lineage for d6pc4b1 (6pc4 B:2-243)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries)

8. Domain d6pc4b1: 6pc4 B:2-243 [384071]
   Other proteins in same PDB: d6pc4a2, d6pc4b2, d6pc4c2, d6pc4d2, d6pc4e_, d6pc4f1, d6pc4f2, d6pc4f3
   automated match to d4drxb1
   complexed with ca, gdp, gtp, mes, mg, o91

Details for d6pc4b1

PDB Entry: 6pc4, 2.6 Å

PDB Description: tubulin-rb3_sld-ttl in complex with compound abi-274

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6pc4b1:

Sequence; same for both SEQRES and ATOM records:

>d6pc4b1 c.32.1.1 (B:2-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d6pc4b1:

• d6pc4b1 first appeared in SCOPe 2.07