Lineage for d6jp9a1 (6jp9 A:1-189)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861542Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2861543Protein automated matches [190116] (28 species)
    not a true protein
  7. 2861629Species Methanocaldococcus jannaschii [TaxId:243232] [383987] (1 PDB entry)
  8. 2861630Domain d6jp9a1: 6jp9 A:1-189 [384063]
    Other proteins in same PDB: d6jp9a2, d6jp9b2, d6jp9c2, d6jp9d2
    automated match to d1gpma1
    complexed with mla, pge, xmp

Details for d6jp9a1

PDB Entry: 6jp9 (more details), 2.1 Å

PDB Description: crsytal structure of a xmp complexed atppase subunit of m. jannaschii gmp synthetase
PDB Compounds: (A:) GMP synthase [glutamine-hydrolyzing] subunit B

SCOPe Domain Sequences for d6jp9a1:

Sequence, based on SEQRES records: (download)

>d6jp9a1 c.26.2.0 (A:1-189) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mfdpkkfideaveeikqqisdrkaiialsggvdssvaavlthkaigdkltavfvdtglmr
kgereevektfrdklglnlivvdakdrflnalkgvtdpeekrkiigklfidvfeeiaedi
kaevlvqgtiapdwietqgkikshhnvalphgmvlevveplrelykdevrllakelglpd
sivyrqpfp

Sequence, based on observed residues (ATOM records): (download)

>d6jp9a1 c.26.2.0 (A:1-189) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mfdpkkfideaveeikqqisdrkaiialsggvdssvaavlthkaigdkltavfvdtglmr
kgereevektfrdklglnlivvdakdrflnalkgvtdpeekrkiigklfidvfeeiaedi
kaevlvqgtiapdhnvalphgmvlevveplrelykdevrllakelglpdsivyrqpfp

SCOPe Domain Coordinates for d6jp9a1:

Click to download the PDB-style file with coordinates for d6jp9a1.
(The format of our PDB-style files is described here.)

Timeline for d6jp9a1: