Lineage for d1a7xa_ (1a7x A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31479Fold d.26: FKBP-like [54533] (3 superfamilies)
  4. 31480Superfamily d.26.1: FKBP-like [54534] (2 families) (S)
  5. 31481Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (5 proteins)
  6. 31489Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
  7. 31493Species Human (Homo sapiens) [TaxId:9606] [54537] (28 PDB entries)
  8. 31517Domain d1a7xa_: 1a7x A: [38405]

Details for d1a7xa_

PDB Entry: 1a7x (more details), 2 Å

PDB Description: fkbp12-fk1012 complex

SCOP Domain Sequences for d1a7xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7xa_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOP Domain Coordinates for d1a7xa_:

Click to download the PDB-style file with coordinates for d1a7xa_.
(The format of our PDB-style files is described here.)

Timeline for d1a7xa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a7xb_