SCOPe 2.08: Domain d6okfb2: 6okf B:254-405

Lineage for d6okfb2 (6okf B:254-405)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Beta-ketoacyl-ACP synthase I, C-terminal domain [419015] (2 species)

7. Species Escherichia coli [TaxId:83333] [419575] (2 PDB entries)

8. Domain d6okfb2: 6okf B:254-405 [384037]
   Other proteins in same PDB: d6okfa1, d6okfb1, d6okfc_, d6okfd_
   automated match to d1fj4a2
   complexed with mrj, na
   has additional insertions and/or extensions that are not grouped together

Details for d6okfb2

PDB Entry: 6okf, 2.5 Å

PDB Description: crosslinked crystal structure of type ii fatty acid synthase ketosynthase, fabb, and c16-crypto acyl carrier protein, acpp

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d6okfb2:

Sequence; same for both SEQRES and ATOM records:

>d6okfb2 c.95.1.1 (B:254-405) Beta-ketoacyl-ACP synthase I, C-terminal domain {Escherichia coli [TaxId: 83333]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklk

Timeline for d6okfb2:

• d6okfb2 first appeared in SCOPe 2.07