SCOPe 2.07: Domain d6okfb1: 6okf B:2-253

Lineage for d6okfb1 (6okf B:2-253)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (10 proteins)

6. Protein Beta-ketoacyl-ACP synthase I [53907] (2 species)

7. Species Escherichia coli [TaxId:83333] [383645] (2 PDB entries)

8. Domain d6okfb1: 6okf B:2-253 [384036]
   Other proteins in same PDB: d6okfc_, d6okfd_
   automated match to d1fj4a1
   complexed with mrj, na

Details for d6okfb1

PDB Entry: 6okf, 2.5 Å

PDB Description: crosslinked crystal structure of type ii fatty acid synthase ketosynthase, fabb, and c16-crypto acyl carrier protein, acpp

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d6okfb1:

Sequence; same for both SEQRES and ATOM records:

>d6okfb1 c.95.1.1 (B:2-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 83333]}
kravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttglid
rkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadamr
gprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlgk
qdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvve
elehalargahi

Timeline for d6okfb1:

• d6okfb1 is new in SCOPe 2.07-stable
  
• d6okfb1 appears in the current release, SCOPe 2.08