Lineage for d6okfb1 (6okf B:2-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916579Protein Beta-ketoacyl-ACP synthase I, N-terminal domain [419014] (2 species)
  7. 2916657Species Escherichia coli [TaxId:83333] [419574] (2 PDB entries)
  8. 2916661Domain d6okfb1: 6okf B:2-253 [384036]
    Other proteins in same PDB: d6okfa2, d6okfb2, d6okfc_, d6okfd_
    automated match to d1fj4a1
    complexed with mrj, na

    has additional insertions and/or extensions that are not grouped together

Details for d6okfb1

PDB Entry: 6okf (more details), 2.5 Å

PDB Description: crosslinked crystal structure of type ii fatty acid synthase ketosynthase, fabb, and c16-crypto acyl carrier protein, acpp
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d6okfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6okfb1 c.95.1.1 (B:2-253) Beta-ketoacyl-ACP synthase I, N-terminal domain {Escherichia coli [TaxId: 83333]}
kravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttglid
rkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadamr
gprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlgk
qdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvve
elehalargahi

SCOPe Domain Coordinates for d6okfb1:

Click to download the PDB-style file with coordinates for d6okfb1.
(The format of our PDB-style files is described here.)

Timeline for d6okfb1: