![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
![]() | Protein Beta-ketoacyl-ACP synthase I, N-terminal domain [419014] (2 species) |
![]() | Species Escherichia coli [TaxId:83333] [419574] (2 PDB entries) |
![]() | Domain d6okfb1: 6okf B:2-253 [384036] Other proteins in same PDB: d6okfa2, d6okfb2, d6okfc_, d6okfd_ automated match to d1fj4a1 complexed with mrj, na has additional insertions and/or extensions that are not grouped together |
PDB Entry: 6okf (more details), 2.5 Å
SCOPe Domain Sequences for d6okfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6okfb1 c.95.1.1 (B:2-253) Beta-ketoacyl-ACP synthase I, N-terminal domain {Escherichia coli [TaxId: 83333]} kravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttglid rkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadamr gprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlgk qdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvve elehalargahi
Timeline for d6okfb1:
![]() Domains from other chains: (mouse over for more information) d6okfa1, d6okfa2, d6okfc_, d6okfd_ |