Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2B [47119] (6 species) |
Species Human (Homo sapiens), H2B.k [TaxId:9606] [140394] (4 PDB entries) Uniprot O60814 30-125 |
Domain d6l9hh_: 6l9h H: [384033] Other proteins in same PDB: d6l9ha_, d6l9hb_, d6l9hc_, d6l9he_, d6l9hf_, d6l9hg_ automated match to d2cv5d1 protein/DNA complex; complexed with mn |
PDB Entry: 6l9h (more details), 2.6 Å
SCOPe Domain Sequences for d6l9hh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l9hh_ a.22.1.1 (H:) Histone H2B {Human (Homo sapiens), H2B.k [TaxId: 9606]} rsrkesysvyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstit sreiqtavrlllpgelakhavsegtkavtkytsa
Timeline for d6l9hh_: