SCOP 1.71: Domain d1fkib_: 1fki B:

Lineage for d1fkib_ (1fki B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (3 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)

6. Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
   cis-trans prolyl-isomerase

7. Species Human (Homo sapiens) [TaxId:9606] [54537] (31 PDB entries)

8. Domain d1fkib_: 1fki B: [38402]
   complexed with sb1

Details for d1fkib_

PDB Entry: 1fki, 2.2 Å

PDB Description: design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12

SCOP Domain Sequences for d1fkib_:

Sequence; same for both SEQRES and ATOM records:

>d1fkib_ d.26.1.1 (B:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d1fkib_:

• d1fkib_ first appeared (with stable ids) in SCOP 1.55
  
• d1fkib_ appears in SCOP 1.69
  
• d1fkib_ appears in SCOP 1.73
  
• d1fkib_ appears in the current release, SCOPe 2.08