Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries) |
Domain d6lb2c2: 6lb2 C:182-276 [384016] Other proteins in same PDB: d6lb2a1, d6lb2b_, d6lb2c1, d6lb2d_ automated match to d1a9ea1 complexed with edo, ekg, zn |
PDB Entry: 6lb2 (more details), 1.69 Å
SCOPe Domain Sequences for d6lb2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lb2c2 b.1.1.0 (C:182-276) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} aeppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpggdgtf qkwgavvvpsgeeqrytchvqheglpepltlrwep
Timeline for d6lb2c2:
View in 3D Domains from other chains: (mouse over for more information) d6lb2a1, d6lb2a2, d6lb2b_, d6lb2d_ |