SCOPe 2.08: Domain d6lb2c2: 6lb2 C:182-276

Lineage for d6lb2c2 (6lb2 C:182-276)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries)

8. Domain d6lb2c2: 6lb2 C:182-276 [384016]
   Other proteins in same PDB: d6lb2a1, d6lb2b_, d6lb2c1, d6lb2d_
   automated match to d1a9ea1
   complexed with edo, ekg, zn

Details for d6lb2c2

PDB Entry: 6lb2, 1.69 Å

PDB Description: crystal structure of rhesus macaque mhc class i molecule mamu-b*098 complexed with mono-acyl glycerol

PDB Compounds: (C:) MHC class I antigen

SCOPe Domain Sequences for d6lb2c2:

Sequence; same for both SEQRES and ATOM records:

>d6lb2c2 b.1.1.0 (C:182-276) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
aeppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpggdgtf
qkwgavvvpsgeeqrytchvqheglpepltlrwep

Timeline for d6lb2c2:

• d6lb2c2 first appeared in SCOPe 2.07