Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [384005] (5 PDB entries) |
Domain d6lahb_: 6lah B: [384006] Other proteins in same PDB: d6laha1, d6laha2, d6lahc1, d6lahc2 automated match to d2xfxb_ complexed with edo, ekg, zn |
PDB Entry: 6lah (more details), 1.87 Å
SCOPe Domain Sequences for d6lahb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lahb_ b.1.1.2 (B:) beta2-microglobulin {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} aiqrtpkiqvysrhppengkpnflncyvsgfhpsdievdllkngekmgkvehsdlsfskd wsfyllyyteftpnekdeyacrvnhvtlsgprtvkwdrdm
Timeline for d6lahb_: