Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries) |
Domain d6k9hb1: 6k9h B:219-459 [383996] Other proteins in same PDB: d6k9ha2, d6k9hb2 automated match to d5i4va_ protein/DNA complex; complexed with d40 |
PDB Entry: 6k9h (more details), 2.5 Å
SCOPe Domain Sequences for d6k9hb1:
Sequence, based on SEQRES records: (download)
>d6k9hb1 a.123.1.1 (B:219-459) automated matches {Human (Homo sapiens) [TaxId: 9606]} qltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpasgsasqqrfahftelaiis vqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskd dfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqp yveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd v
>d6k9hb1 a.123.1.1 (B:219-459) automated matches {Human (Homo sapiens) [TaxId: 9606]} qltaaqelmiqqlvaaqlqvtpwpasqqrfahftelaiisvqeivdfakqvpgflqlgre dqiallkastieimlletarrynhetecilkdftyskddfhraglqvefinpifefsram rrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsytrikrpqdqlrfpr mlmklvslrtlssvhseqvfalrlqklppllseiwdv
Timeline for d6k9hb1: