SCOPe 2.08: Domain d6jp9d2: 6jp9 D:190-310

Lineage for d6jp9d2 (6jp9 D:190-310)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (2 families)
   automatically mapped to Pfam PF00958

5. Family d.52.2.0: automated matches [227193] (1 protein)
   not a true family

6. Protein automated matches [226919] (5 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:243232] [383992] (1 PDB entry)

8. Domain d6jp9d2: 6jp9 D:190-310 [383993]
   Other proteins in same PDB: d6jp9a1, d6jp9b1, d6jp9c1, d6jp9d1
   automated match to d1gpma3
   complexed with mla, pge, xmp

Details for d6jp9d2

PDB Entry: 6jp9, 2.1 Å

PDB Description: crsytal structure of a xmp complexed atppase subunit of m. jannaschii gmp synthetase

PDB Compounds: (D:) GMP synthase [glutamine-hydrolyzing] subunit B

SCOPe Domain Sequences for d6jp9d2:

Sequence, based on SEQRES records:

>d6jp9d2 d.52.2.0 (D:190-310) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
gpglavrvlgevteeklnicreanaiveeevkkanldkdlwqyfavvldckatgvkgder
eynwivalrmvksldamtahvpeipfdllkriskritseipnvarvvfditdkppatief
e

Sequence, based on observed residues (ATOM records):

>d6jp9d2 d.52.2.0 (D:190-310) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
gpglavrvlgevteeklnicreanaiveeevkkanldkdlwqyfavvldckatgvderey
nwivalrmvksldamtahvpeipfdllkriskritseipnvarvvfditdkppatiefe

Timeline for d6jp9d2:

• d6jp9d2 first appeared in SCOPe 2.07