SCOPe 2.08: Domain d6jp9d1: 6jp9 D:1-189

Lineage for d6jp9d1 (6jp9 D:1-189)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (28 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:243232] [383987] (1 PDB entry)

8. Domain d6jp9d1: 6jp9 D:1-189 [383990]
   Other proteins in same PDB: d6jp9a2, d6jp9b2, d6jp9c2, d6jp9d2
   automated match to d1gpma1
   complexed with mla, pge, xmp

Details for d6jp9d1

PDB Entry: 6jp9, 2.1 Å

PDB Description: crsytal structure of a xmp complexed atppase subunit of m. jannaschii gmp synthetase

PDB Compounds: (D:) GMP synthase [glutamine-hydrolyzing] subunit B

SCOPe Domain Sequences for d6jp9d1:

Sequence, based on SEQRES records:

>d6jp9d1 c.26.2.0 (D:1-189) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mfdpkkfideaveeikqqisdrkaiialsggvdssvaavlthkaigdkltavfvdtglmr
kgereevektfrdklglnlivvdakdrflnalkgvtdpeekrkiigklfidvfeeiaedi
kaevlvqgtiapdwietqgkikshhnvalphgmvlevveplrelykdevrllakelglpd
sivyrqpfp

Sequence, based on observed residues (ATOM records):

>d6jp9d1 c.26.2.0 (D:1-189) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mfdpkkfideaveeikqqisdrkaiialsggvdssvaavlthkaigdkltavfvdtglmr
kgereevektfrdklglnlivvdakdrflnalkgvtdpeekrkiigklfidvfeeiaedi
kaevlvqgtiapdwhnvalphgmvlevveplrelykdevrllakelglpdsivyrqpfp

Timeline for d6jp9d1:

• d6jp9d1 first appeared in SCOPe 2.07