Lineage for d1d7ib_ (1d7i B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941354Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 2941358Species Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries)
  8. 2941391Domain d1d7ib_: 1d7i B: [38397]
    complexed with dss, nh4, so4

Details for d1d7ib_

PDB Entry: 1d7i (more details), 1.9 Å

PDB Description: fkbp complexed with methyl methylsulfinylmethyl sulfide (dss)
PDB Compounds: (B:) protein (fk506-binding protein)

SCOPe Domain Sequences for d1d7ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7ib_ d.26.1.1 (B:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOPe Domain Coordinates for d1d7ib_:

Click to download the PDB-style file with coordinates for d1d7ib_.
(The format of our PDB-style files is described here.)

Timeline for d1d7ib_: