SCOP 1.69: Domain d3fapa_: 3fap A:

Lineage for d3fapa_ (3fap A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (3 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)

6. Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
   cis-trans prolyl-isomerase

7. Species Human (Homo sapiens) [TaxId:9606] [54537] (31 PDB entries)

8. Domain d3fapa_: 3fap A: [38395]
   Other proteins in same PDB: d3fapb_

Details for d3fapa_

PDB Entry: 3fap, 1.85 Å

PDB Description: atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap

SCOP Domain Sequences for d3fapa_:

Sequence; same for both SEQRES and ATOM records:

>d3fapa_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d3fapa_:

• d3fapa_ first appeared (with stable ids) in SCOP 1.55
  
• d3fapa_ appears in SCOP 1.67
  
• d3fapa_ appears in SCOP 1.71
  
• d3fapa_ appears in the current release, SCOPe 2.08