SCOPe 2.08: Domain d6ylal2: 6yla L:113-219

Lineage for d6ylal2 (6yla L:113-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6ylal2: 6yla L:113-219 [383940]
   Other proteins in same PDB: d6ylaa_, d6ylab_, d6ylac1, d6ylae1, d6ylae2, d6ylah_, d6ylal1
   automated match to d1dn0a2
   complexed with 1pe, dms, mli, nag, pg0

Details for d6ylal2

PDB Entry: 6yla, 2.42 Å

PDB Description: crystal structure of the sars-cov-2 receptor binding domain in complex with cr3022 fab

PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d6ylal2:

Sequence; same for both SEQRES and ATOM records:

>d6ylal2 b.1.1.2 (L:113-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6ylal2:

• d6ylal2 first appeared in SCOPe 2.07