Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d6ylal2: 6yla L:113-219 [383940] Other proteins in same PDB: d6ylaa_, d6ylab_, d6ylac1, d6ylae1, d6ylae2, d6ylah_, d6ylal1 automated match to d1dn0a2 complexed with 1pe, dms, mli, nag, pg0 |
PDB Entry: 6yla (more details), 2.42 Å
SCOPe Domain Sequences for d6ylal2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ylal2 b.1.1.2 (L:113-219) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d6ylal2: