Lineage for d6rsyf2 (6rsy F:183-275)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2746845Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2747140Domain d6rsyf2: 6rsy F:183-275 [383932]
    Other proteins in same PDB: d6rsya1, d6rsyb1, d6rsyb2, d6rsyd1, d6rsyd2, d6rsye1, d6rsye2, d6rsyf1, d6rsyg1, d6rsyg2, d6rsyi1, d6rsyi2, d6rsyj1, d6rsyj2
    automated match to d1ogaa1
    complexed with edo

Details for d6rsyf2

PDB Entry: 6rsy (more details), 2.95 Å

PDB Description: the complex between tcr a7b2 and human class i mhc hla-a0201-wt1 with the bound rmfpnapyl peptide.
PDB Compounds: (F:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d6rsyf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rsyf2 b.1.1.2 (F:183-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrw

SCOPe Domain Coordinates for d6rsyf2:

Click to download the PDB-style file with coordinates for d6rsyf2.
(The format of our PDB-style files is described here.)

Timeline for d6rsyf2: