SCOPe 2.08: Domain d6rsyf1: 6rsy F:2-182

Lineage for d6rsyf1 (6rsy F:2-182)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
   Uniprot P01892 25-298

8. Domain d6rsyf1: 6rsy F:2-182 [383931]
   Other proteins in same PDB: d6rsya2, d6rsyb1, d6rsyb2, d6rsyd1, d6rsyd2, d6rsye1, d6rsye2, d6rsyf2, d6rsyg1, d6rsyg2, d6rsyi1, d6rsyi2, d6rsyj1, d6rsyj2
   automated match to d1ogaa2
   complexed with edo

Details for d6rsyf1

PDB Entry: 6rsy, 2.95 Å

PDB Description: the complex between tcr a7b2 and human class i mhc hla-a0201-wt1 with the bound rmfpnapyl peptide.

PDB Compounds: (F:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d6rsyf1:

Sequence; same for both SEQRES and ATOM records:

>d6rsyf1 d.19.1.1 (F:2-182) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d6rsyf1:

• d6rsyf1 first appeared in SCOPe 2.07