SCOPe 2.08: Domain d6yijb1: 6yij B:1081-1197

Lineage for d6yijb1 (6yij B:1081-1197)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries)

8. Domain d6yijb1: 6yij B:1081-1197 [383927]
   Other proteins in same PDB: d6yija2, d6yijb2, d6yijc2, d6yijf2
   automated match to d4nyxa_
   complexed with osn

Details for d6yijb1

PDB Entry: 6yij, 2.2 Å

PDB Description: crystal structure of the crebbp bromodomain in complex with a benzo- diazepine ligand

PDB Compounds: (B:) crebbp

SCOPe Domain Sequences for d6yijb1:

Sequence; same for both SEQRES and ATOM records:

>d6yijb1 a.29.2.1 (B:1081-1197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

Timeline for d6yijb1:

• d6yijb1 first appeared in SCOPe 2.07