Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
Protein automated matches [190183] (10 species) not a true protein |
Species Zika virus zikv/h. sapiens/frenchpolynesia/10087pf/2013 [TaxId:2043570] [377146] (2 PDB entries) |
Domain d6utac_: 6uta C: [383916] Other proteins in same PDB: d6utaa_, d6utab1, d6utab2, d6utah_, d6utal1, d6utal2 automated match to d5omza_ |
PDB Entry: 6uta (more details), 3.1 Å
SCOPe Domain Sequences for d6utac_:
Sequence, based on SEQRES records: (download)
>d6utac_ b.1.18.4 (C:) automated matches {Zika virus zikv/h. sapiens/frenchpolynesia/10087pf/2013 [TaxId: 2043570]} syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp vitestenskmmleldppfgdsyivigvgekkithhwhrs
>d6utac_ b.1.18.4 (C:) automated matches {Zika virus zikv/h. sapiens/frenchpolynesia/10087pf/2013 [TaxId: 2043570]} syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavmqtltpvgrlitanpv itestenskmmleldppfgdsyivigvgekkithhwhrs
Timeline for d6utac_: