Lineage for d6utac_ (6uta C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765451Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2765495Protein automated matches [190183] (10 species)
    not a true protein
  7. 2765529Species Zika virus zikv/h. sapiens/frenchpolynesia/10087pf/2013 [TaxId:2043570] [377146] (2 PDB entries)
  8. 2765532Domain d6utac_: 6uta C: [383916]
    Other proteins in same PDB: d6utaa_, d6utab1, d6utab2, d6utah_, d6utal1, d6utal2
    automated match to d5omza_

Details for d6utac_

PDB Entry: 6uta (more details), 3.1 Å

PDB Description: crystal structure of z004 igl fab in complex with zikv ediii
PDB Compounds: (C:) Env

SCOPe Domain Sequences for d6utac_:

Sequence, based on SEQRES records: (download)

>d6utac_ b.1.18.4 (C:) automated matches {Zika virus zikv/h. sapiens/frenchpolynesia/10087pf/2013 [TaxId: 2043570]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrs

Sequence, based on observed residues (ATOM records): (download)

>d6utac_ b.1.18.4 (C:) automated matches {Zika virus zikv/h. sapiens/frenchpolynesia/10087pf/2013 [TaxId: 2043570]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavmqtltpvgrlitanpv
itestenskmmleldppfgdsyivigvgekkithhwhrs

SCOPe Domain Coordinates for d6utac_:

Click to download the PDB-style file with coordinates for d6utac_.
(The format of our PDB-style files is described here.)

Timeline for d6utac_: