Lineage for d1d7jb_ (1d7j B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies) Superfamily d.26.1: FKBP-like [54534] (2 families) 
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (5 proteins) 
Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species) Species Human (Homo sapiens) [TaxId:9606] [54537] (28 PDB entries) 
Domain d1d7jb_: 1d7j B: [38390]
Details for d1d7jb_
PDB Entry: 1d7j (more details), 1.85 Å
PDB Description: fkbp complexed with 4-hydroxy-2-butanone
SCOP Domain Sequences for d1d7jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7jb_ d.26.1.1 (B:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
SCOP Domain Coordinates for d1d7jb_:
Click to download the PDB-style file with coordinates for d1d7jb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d7jb_:
- d1d7jb_ appears in SCOP 1.57
- d1d7jb_ appears in the current release, SCOPe 2.08
View in 3D
