Lineage for d6p79l_ (6p79 L:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) 
Domain d6p79l_: 6p79 L: [383888]
Other proteins in same PDB: d6p79h_
automated match to d1igml_
Details for d6p79l_
PDB Entry: 6p79 (more details), 1.58 Å
PDB Description: engineered single chain antibody c9+c14 scfv
PDB Compounds: (L:) Engineered antibody light chainSCOPe Domain Sequences for d6p79l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p79l_ b.1.1.1 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspaklwasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfwstpwtfgggtklmikr
SCOPe Domain Coordinates for d6p79l_:
Click to download the PDB-style file with coordinates for d6p79l_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6p79l_:
- d6p79l_ first appeared in SCOPe 2.07
View in 3D
