Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (58 species) not a true protein |
Species Bacillus anthracis [TaxId:1392] [373291] (6 PDB entries) |
Domain d6tqxa_: 6tqx A: [383885] automated match to d4bmqa_ complexed with so4 |
PDB Entry: 6tqx (more details), 2.05 Å
SCOPe Domain Sequences for d6tqxa_:
Sequence, based on SEQRES records: (download)
>d6tqxa_ a.25.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 1392]} mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl gdtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeideifdwv dthpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk ltasgeiinliirdesihgvfvgilaqqifaelsaedqqevqketqellmelyeiemayt eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlnglr
>d6tqxa_ a.25.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 1392]} mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl gdtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeideifdwv dthpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk ltasgeiinliirdesihgvfvgilaqqifaelsaedqqevqketqellmelyeiemayt eeiytsiglvedvnrfvrynankglmnlglepkfeinpivlnglr
Timeline for d6tqxa_: