SCOPe 2.08: Domain d6u7ca1: 6u7c A:30-185

Lineage for d6u7ca1 (6u7c A:30-185)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)

8. Domain d6u7ca1: 6u7c A:30-185 [383872]
   Other proteins in same PDB: d6u7ca2, d6u7ca3, d6u7cb_, d6u7cg_
   automated match to d3v5wa1
   complexed with mg, q1y

Details for d6u7ca1

PDB Entry: 6u7c, 2.44 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg258747

PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d6u7ca1:

Sequence; same for both SEQRES and ATOM records:

>d6u7ca1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei
kkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqpy
ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

Timeline for d6u7ca1:

• d6u7ca1 first appeared in SCOPe 2.07