Lineage for d2fke__ (2fke -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79020Fold d.26: FKBP-like [54533] (3 superfamilies)
  4. 79021Superfamily d.26.1: FKBP-like [54534] (2 families) (S)
  5. 79022Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (7 proteins)
  6. 79030Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
  7. 79034Species Human (Homo sapiens) [TaxId:9606] [54537] (28 PDB entries)
  8. 79040Domain d2fke__: 2fke - [38387]

Details for d2fke__

PDB Entry: 2fke (more details), 1.72 Å

PDB Description: fk-506-binding protein: three-dimensional structure of the complex with the antagonist l-685,818

SCOP Domain Sequences for d2fke__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fke__ d.26.1.1 (-) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOP Domain Coordinates for d2fke__:

Click to download the PDB-style file with coordinates for d2fke__.
(The format of our PDB-style files is described here.)

Timeline for d2fke__: