Lineage for d1fkfa_ (1fkf A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720426Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 720427Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 720438Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 720442Species Human (Homo sapiens) [TaxId:9606] [54537] (32 PDB entries)
  8. 720446Domain d1fkfa_: 1fkf A: [38386]
    complexed with fk5

Details for d1fkfa_

PDB Entry: 1fkf (more details), 1.7 Å

PDB Description: atomic structure of fkbp-fk506, an immunophilin-immunosuppressant complex
PDB Compounds: (A:) fk506 binding protein

SCOP Domain Sequences for d1fkfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkfa_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOP Domain Coordinates for d1fkfa_:

Click to download the PDB-style file with coordinates for d1fkfa_.
(The format of our PDB-style files is described here.)

Timeline for d1fkfa_: