Lineage for d6xxja_ (6xxj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862580Family c.31.1.1: Deoxyhypusine synthase, DHS [52468] (2 proteins)
    automatically mapped to Pfam PF01916
  6. 2862581Protein Deoxyhypusine synthase, DHS [52469] (1 species)
  7. 2862582Species Human (Homo sapiens) [TaxId:9606] [52470] (14 PDB entries)
    Uniprot P49366
  8. 2862583Domain d6xxja_: 6xxj A: [383850]
    automated match to d1rlza_
    complexed with act, bme, edo, fmt, mrd, nad, oxm, pge, spd

Details for d6xxja_

PDB Entry: 6xxj (more details), 1.41 Å

PDB Description: crystal structure of human deoxyhypusine synthase in complex with spermidine and nad
PDB Compounds: (A:) deoxyhypusine synthase

SCOPe Domain Sequences for d6xxja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xxja_ c.31.1.1 (A:) Deoxyhypusine synthase, DHS {Human (Homo sapiens) [TaxId: 9606]}
eapagalaavlkhsstlppestqvrgydfnrgvnyralleafgttgfqatnfgravqqvn
amiekkleplsqdedqhadltqsrrpltsctiflgytsnlissgiretirylvqhnmvdv
lvttaggveedlikclaptylgefslrgkelrenginrignllvpnenyckfedwlmpil
dqmvmeqntegvkwtpskmiarlgkeinnpesvyywaqknhipvfspaltdgslgdmiff
hsyknpglvldivedlrlintqaifakctgmiilgggvvkhhiananlmrngadyavyin
taqefdgsdsgarpdeavswgkirvdaqpvkvyadaslvfpllvaetfaqkmdafm

SCOPe Domain Coordinates for d6xxja_:

Click to download the PDB-style file with coordinates for d6xxja_.
(The format of our PDB-style files is described here.)

Timeline for d6xxja_: