SCOPe 2.08: Domain d6tqwa_: 6tqw A:

Lineage for d6tqwa_ (6tqw A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (60 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:260799] [373248] (4 PDB entries)

8. Domain d6tqwa_: 6tqw A: [383848]
   automated match to d4bmqa_
   complexed with mn, so4

Details for d6tqwa_

PDB Entry: 6tqw, 1.55 Å

PDB Description: crystal structure of ribonucleotide reductase nrdf from bacillus anthracis anaerobically soaked with fe(ii) and mn(ii) ions

PDB Compounds: (A:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d6tqwa_:

Sequence; same for both SEQRES and ATOM records:

>d6tqwa_ a.25.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 260799]}
mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl
ldtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeideifdwv
dthpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk
ltasgeiinliirdesihgvfvgilaqqifaelsaedqqevqketqellmelyeiemayt
eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlnglr

Timeline for d6tqwa_:

• d6tqwa_ first appeared in SCOPe 2.07