SCOPe 2.08: Domain d6wgra1: 6wgr A:25-281

Lineage for d6wgra1 (6wgr A:25-281)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225094] (5 PDB entries)

8. Domain d6wgra1: 6wgr A:25-281 [383842]
   Other proteins in same PDB: d6wgra2, d6wgrb2, d6wgrc2
   automated match to d3leza_
   complexed with epe, gol

Details for d6wgra1

PDB Entry: 6wgr, 1.88 Å

PDB Description: the crystal structure of a beta-lactamase from staphylococcus aureus subsp. aureus usa300_tch1516

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6wgra1:

Sequence; same for both SEQRES and ATOM records:

>d6wgra1 e.3.1.0 (A:25-281) automated matches {Staphylococcus aureus [TaxId: 1280]}
kelndlekkynahigvyalntksgkevkfnsdkrfayastskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkelieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskknknflldlmfn
nkngdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
pndklisetaksvmkef

Timeline for d6wgra1:

• d6wgra1 first appeared in SCOPe 2.07