Lineage for d6wa7b_ (6wa7 B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619196Protein automated matches [190161] (30 species)
    not a true protein
  7. 2619279Species Escherichia coli [TaxId:1269009] [383839] (1 PDB entry)
  8. 2619281Domain d6wa7b_: 6wa7 B: [383840]
    automated match to d2hdsa_
    complexed with edo, peg, pge, tbi

Details for d6wa7b_

PDB Entry: 6wa7 (more details), 2.7 Å

PDB Description: class c beta-lactamase from escherichia coli in complex with tazobactam
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6wa7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wa7b_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 1269009]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamktrvfqplk
lnhtwinvpsaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdiiingsdnkialaarpvkpitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq

SCOPe Domain Coordinates for d6wa7b_:

Click to download the PDB-style file with coordinates for d6wa7b_.
(The format of our PDB-style files is described here.)

Timeline for d6wa7b_:

  • d6wa7b_ is new in SCOPe 2.07-stable
  • d6wa7b_ does not appear in SCOPe 2.08