Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein automated matches [190161] (30 species) not a true protein |
Species Escherichia coli [TaxId:1269009] [383839] (1 PDB entry) |
Domain d6wa7b_: 6wa7 B: [383840] automated match to d2hdsa_ complexed with edo, peg, pge, tbi |
PDB Entry: 6wa7 (more details), 2.7 Å
SCOPe Domain Sequences for d6wa7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wa7b_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 1269009]} apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamktrvfqplk lnhtwinvpsaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdiiingsdnkialaarpvkpitp ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq
Timeline for d6wa7b_: