SCOPe 2.07: Domain d6rsyi1: 6rsy I:2-114

Lineage for d6rsyi1 (6rsy I:2-114)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6rsyi1: 6rsy I:2-114 [383834]
   Other proteins in same PDB: d6rsya1, d6rsya2, d6rsyb1, d6rsyb2, d6rsyd2, d6rsyf1, d6rsyf2, d6rsyg1, d6rsyg2, d6rsyi2
   automated match to d4z7vg1
   complexed with edo

Details for d6rsyi1

PDB Entry: 6rsy, 2.95 Å

PDB Description: the complex between tcr a7b2 and human class i mhc hla-a0201-wt1 with the bound rmfpnapyl peptide.

PDB Compounds: (I:) a7b2 ALPHA CHAIN

SCOPe Domain Sequences for d6rsyi1:

Sequence; same for both SEQRES and ATOM records:

>d6rsyi1 b.1.1.0 (I:2-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adakttqppsmdcaegraanlpcnhstvdpneyvywyrqihsqgpqyiihglknnetnem
asliitedrksstlilphatlrdtavyycigggttsgtykyifgtgtrlkvla

Timeline for d6rsyi1:

• d6rsyi1 is new in SCOPe 2.07-stable
  
• d6rsyi1 appears in the current release, SCOPe 2.08