Lineage for d6ujla_ (6ujl A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418399Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2418634Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2418635Protein automated matches [190568] (9 species)
    not a true protein
  7. 2418681Species Human (Homo sapiens) [TaxId:9606] [187559] (91 PDB entries)
  8. 2418739Domain d6ujla_: 6ujl A: [383827]
    automated match to d6ucsa_
    complexed with qbm

Details for d6ujla_

PDB Entry: 6ujl (more details), 1.6 Å

PDB Description: discovery of fragment-inspired heterocyclic benzenesulfonamides as inhibitors of the wdr5-myc interaction
PDB Compounds: (A:) WD repeat-containing protein 5

SCOPe Domain Sequences for d6ujla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ujla_ b.69.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklg
isdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsf
desvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktl
idddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvt
ggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktikl
wksdc

SCOPe Domain Coordinates for d6ujla_:

Click to download the PDB-style file with coordinates for d6ujla_.
(The format of our PDB-style files is described here.)

Timeline for d6ujla_: