SCOPe 2.08: Domain d6ti4a_: 6ti4 A:

Lineage for d6ti4a_ (6ti4 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein automated matches [190152] (25 species)
   not a true protein

7. Species Streptococcus thermophilus [TaxId:1308] [383816] (1 PDB entry)

8. Domain d6ti4a_: 6ti4 A: [383817]
   automated match to d4wxga_
   complexed with gol, mg, o3z

Details for d6ti4a_

PDB Entry: 6ti4, 1.93 Å

PDB Description: shmt from streptococcus thermophilus tyr55ser variant in complex with plp/d-serine/lys230 gem diamine complex

PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d6ti4a_:

Sequence; same for both SEQRES and ATOM records:

>d6ti4a_ c.67.1.4 (A:) automated matches {Streptococcus thermophilus [TaxId: 1308]}
dykafdpelwnaidaeaerqqnnieliasenvvskavmaaqgtlltnksaegypgkryyg
gtavidvvetlaierakklfgakfanvqphsgsqanaavymsliqpgdtvmgmdlsaggh
lthgapvsfsgktynfvsynvdkeselldydailaqakevrpklivagasaysriidfak
freiadavgaylmvdmahiaglvasghhpspvpyahvttttthktlrgprggliltdded
iakklnsavfpglqggplehviaakavalkealdpafkeygenviknaaamadvfnqhpd
frvisggtnnhlflvdvtkvvengkvaqnvleevnitlnknsipyeqlspfktsgirvgs
paitsrgmgeaesrqiaewmvealenhdkpevlerirgdvkvltdafply

Timeline for d6ti4a_:

• d6ti4a_ first appeared in SCOPe 2.07