SCOPe 2.08: Domain d6utej2: 6ute J:107-213

Lineage for d6utej2 (6ute J:107-213)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

Domain d6utej2: 6ute J:107-213 [383811]
Other proteins in same PDB: d6utea_, d6uteb1, d6utec_, d6uted1, d6utee_, d6utef1, d6uteg_, d6uteh1, d6utei_, d6utej1, d6utes_
automated match to d1dn0a2
complexed with gol

Details for d6utej2

PDB Entry: 6ute (more details), 2.9 Å

PDB Description: crystal structure of z032 fab in complex with wnv ediii

PDB Compounds: (J:) Z032 Fab light chain

SCOPe Domain Sequences for d6utej2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6utej2 b.1.1.2 (J:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6utej2:

Click to download the PDB-style file with coordinates for d6utej2.
(The format of our PDB-style files is described here.)

Timeline for d6utej2: