Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d6p79h_: 6p79 H: [383805] Other proteins in same PDB: d6p79l_ automated match to d5c2bh_ |
PDB Entry: 6p79 (more details), 1.58 Å
SCOPe Domain Sequences for d6p79h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p79h_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} evqlqqsgpelvkpgasvklsctasgfnikdtfmhwvkqrpeqglewigridpangntey dpkfqgkatitadtssntvnlqlssltsedtavyycasggelgfpywgqgtlvtvsagg
Timeline for d6p79h_: