Lineage for d1p32a_ (1p32 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2165762Fold d.25: Mitochondrial glycoprotein MAM33-like [54528] (1 superfamily)
    core: beta(7)-alpha(2); N- and C-terminal extensions form a coiled coil subdomain
  4. 2165763Superfamily d.25.1: Mitochondrial glycoprotein MAM33-like [54529] (2 families) (S)
  5. 2165764Family d.25.1.1: Mitochondrial glycoprotein MAM33-like [54530] (2 protein domains)
  6. 2165765Protein Acidic mitochondrial matrix protein p32 [54531] (1 species)
  7. 2165766Species Human (Homo sapiens) [TaxId:9606] [54532] (1 PDB entry)
  8. 2165767Domain d1p32a_: 1p32 A: [38379]

Details for d1p32a_

PDB Entry: 1p32 (more details), 2.25 Å

PDB Description: crystal structure of human p32, a doughnut-shaped acidic mitochondrial matrix protein
PDB Compounds: (A:) mitochondrial matrix protein, sf2p32

SCOPe Domain Sequences for d1p32a_:

Sequence, based on SEQRES records: (download)

>d1p32a_ d.25.1.1 (A:) Acidic mitochondrial matrix protein p32 {Human (Homo sapiens) [TaxId: 9606]}
mhtdgdkafvdflsdeikeerkiqkhktlpkmsggwelelngteaklvrkvagekitvtf
ninnsipptfdgeeepsqgqkveeqepeltstpnfvveviknddgkkalvldchypedev
gqedeaesdifsirevsfqstgesewkdtnytlntdsldwalydhlmdfladrgvdntfa
delvelstalehqeyitfledlksfvksq

Sequence, based on observed residues (ATOM records): (download)

>d1p32a_ d.25.1.1 (A:) Acidic mitochondrial matrix protein p32 {Human (Homo sapiens) [TaxId: 9606]}
mhtdgdkafvdflsdeikeerkiqkhktlpkmsggwelelngteaklvrkvagekitvtf
ninnsipltstpnfvveviknddgkkalvldchypedeaesdifsirevsfqstgesewk
dtnytlntdsldwalydhlmdfladrgvdntfadelvelstalehqeyitfledlksfvk
sq

SCOPe Domain Coordinates for d1p32a_:

Click to download the PDB-style file with coordinates for d1p32a_.
(The format of our PDB-style files is described here.)

Timeline for d1p32a_: