Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [373291] (6 PDB entries) |
Domain d6tqza_: 6tqz A: [383789] automated match to d4bmqa_ complexed with fe2, mn, so4 |
PDB Entry: 6tqz (more details), 2.1 Å
SCOPe Domain Sequences for d6tqza_:
Sequence, based on SEQRES records: (download)
>d6tqza_ a.25.1.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl gdtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeideifdwv dthpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk ltasgeiinliirdesihgvfvgilaqqifaelsaedqqevqketqellmelyeiemayt eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlngl
>d6tqza_ a.25.1.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl gdtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeideifdwv dthpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk ltasgeiinliirdesihgvfvgilaqqifaelsaedqqevqketqellmelyeiemayt eeiytsiglvedvnrfvrynankglmnlglepkfeeinpivlngl
Timeline for d6tqza_: