SCOP 1.71: Domain d1dzoa_: 1dzo A:

Lineage for d1dzoa_ (1dzo A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (3 families)
   bacterial filament proteins

5. Family d.24.1.1: Pilin [54524] (4 proteins)

6. Protein Type IV Pilin Pak [109620] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [54527] (2 PDB entries)

8. Domain d1dzoa_: 1dzo A: [38378]
   mutant

Details for d1dzoa_

PDB Entry: 1dzo, 1.63 Å

PDB Description: truncated pak pilin from pseudomonas aeruginosa

SCOP Domain Sequences for d1dzoa_:

Sequence; same for both SEQRES and ATOM records:

>d1dzoa_ d.24.1.1 (A:) Type IV Pilin Pak {Pseudomonas aeruginosa}
gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr

Timeline for d1dzoa_:

• d1dzoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1dzoa_ appears in SCOP 1.69
  
• d1dzoa_ appears in SCOP 1.73
  
• d1dzoa_ appears in the current release, SCOPe 2.08, called d1dzoa1