Lineage for d1dzoa_ (1dzo A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31462Fold d.24: Pilin [54522] (1 superfamily)
  4. 31463Superfamily d.24.1: Pilin [54523] (1 family) (S)
  5. 31464Family d.24.1.1: Pilin [54524] (1 protein)
  6. 31465Protein Pilin [54525] (2 species)
  7. 31469Species Pseudomonas aeruginosa [TaxId:287] [54527] (1 PDB entry)
  8. 31470Domain d1dzoa_: 1dzo A: [38378]

Details for d1dzoa_

PDB Entry: 1dzo (more details), 1.63 Å

PDB Description: truncated pak pilin from pseudomonas aeruginosa

SCOP Domain Sequences for d1dzoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzoa_ d.24.1.1 (A:) Pilin {Pseudomonas aeruginosa}
gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr

SCOP Domain Coordinates for d1dzoa_:

Click to download the PDB-style file with coordinates for d1dzoa_.
(The format of our PDB-style files is described here.)

Timeline for d1dzoa_: