Lineage for d1dzoa1 (1dzo A:29-144)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509472Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2509473Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2509474Family d.24.1.1: Pilin [54524] (5 protein domains)
  6. 2509486Protein Type IV Pilin Pak [109620] (1 species)
  7. 2509487Species Pseudomonas aeruginosa [TaxId:287] [54527] (3 PDB entries)
  8. 2509491Domain d1dzoa1: 1dzo A:29-144 [38378]
    Other proteins in same PDB: d1dzoa2

Details for d1dzoa1

PDB Entry: 1dzo (more details), 1.63 Å

PDB Description: truncated pak pilin from pseudomonas aeruginosa
PDB Compounds: (A:) type IV pilin

SCOPe Domain Sequences for d1dzoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzoa1 d.24.1.1 (A:29-144) Type IV Pilin Pak {Pseudomonas aeruginosa [TaxId: 287]}
arsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgtialk
pdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr

SCOPe Domain Coordinates for d1dzoa1:

Click to download the PDB-style file with coordinates for d1dzoa1.
(The format of our PDB-style files is described here.)

Timeline for d1dzoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dzoa2