Lineage for d6rsyj1 (6rsy J:4-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2759139Domain d6rsyj1: 6rsy J:4-116 [383772]
    Other proteins in same PDB: d6rsya1, d6rsya2, d6rsyb1, d6rsyb2, d6rsyd2, d6rsyf1, d6rsyf2, d6rsyg1, d6rsyg2, d6rsyi2
    automated match to d3q5ya1
    complexed with edo

Details for d6rsyj1

PDB Entry: 6rsy (more details), 2.95 Å

PDB Description: the complex between tcr a7b2 and human class i mhc hla-a0201-wt1 with the bound rmfpnapyl peptide.
PDB Compounds: (J:) DMF4 beta chain

SCOPe Domain Sequences for d6rsyj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rsyj1 b.1.1.0 (J:4-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsqdprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksrlls
drfsaerpkgsfstleiqrteqgdsamylcasslgfgrdvmrfgpgtrllvle

SCOPe Domain Coordinates for d6rsyj1:

Click to download the PDB-style file with coordinates for d6rsyj1.
(The format of our PDB-style files is described here.)

Timeline for d6rsyj1: