Lineage for d1ay2a_ (1ay2 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509472Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2509473Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2509474Family d.24.1.1: Pilin [54524] (5 protein domains)
  6. 2509475Protein Pilin Gc [109618] (1 species)
  7. 2509476Species Neisseria gonorrhoeae [TaxId:485] [54526] (2 PDB entries)
  8. 2509478Domain d1ay2a_: 1ay2 A: [38377]
    complexed with hto, pt

Details for d1ay2a_

PDB Entry: 1ay2 (more details), 2.6 Å

PDB Description: structure of the fiber-forming protein pilin at 2.6 angstroms resolution
PDB Compounds: (A:) type 4 pilin

SCOPe Domain Sequences for d1ay2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ay2a_ d.24.1.1 (A:) Pilin Gc {Neisseria gonorrhoeae [TaxId: 485]}
ftlielmiviaivgilaavalpayqdytaraqvseaillaegqksavteyylnhgkwpen
ntsagvasppsdikgkyvkevevkngvvtatmlssgvnneikgkklslwarrengsvkwf
cgqpvtrtdddtvadakdgkeidtkhlpstcrdnfdak

SCOPe Domain Coordinates for d1ay2a_:

Click to download the PDB-style file with coordinates for d1ay2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ay2a_: