Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (28 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [383110] (2 PDB entries) |
Domain d6rnga_: 6rng A: [383756] automated match to d2alda_ complexed with gly, pro, so4 |
PDB Entry: 6rng (more details), 2.15 Å
SCOPe Domain Sequences for d6rnga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rnga_ c.1.10.1 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ftskfadelianaayigtpgkgilaadestgtigkrlasinvenvesnrralrellfttp galpclsgvilfeetlyqkssdgtpfvdmlksagvlpgikvdkgtvelagtngetttqgl dglgdrckkyyeagarfakwravlkigvnepsqlaihenayglaryavicqenglvpive peilvdgshdiqkcaavtervlaacykalsdhhvllegtllkpnmvtpgsesakvapevi aehtvralqrtvpaavpaivflsggqseeeatrnlnamnqlktkkpwslsfsfgralqqs tlktwggkeenvkkaqeaflvrckanseatlgaykgd
Timeline for d6rnga_: