Lineage for d6rnga_ (6rng A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835285Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [383110] (2 PDB entries)
  8. 2835286Domain d6rnga_: 6rng A: [383756]
    automated match to d2alda_
    complexed with gly, pro, so4

Details for d6rnga_

PDB Entry: 6rng (more details), 2.15 Å

PDB Description: dipeptide gly-pro binds to a glycolytic enzyme fructose bisphosphate aldolase
PDB Compounds: (A:) Fructose-bisphosphate aldolase 6, cytosolic

SCOPe Domain Sequences for d6rnga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rnga_ c.1.10.1 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ftskfadelianaayigtpgkgilaadestgtigkrlasinvenvesnrralrellfttp
galpclsgvilfeetlyqkssdgtpfvdmlksagvlpgikvdkgtvelagtngetttqgl
dglgdrckkyyeagarfakwravlkigvnepsqlaihenayglaryavicqenglvpive
peilvdgshdiqkcaavtervlaacykalsdhhvllegtllkpnmvtpgsesakvapevi
aehtvralqrtvpaavpaivflsggqseeeatrnlnamnqlktkkpwslsfsfgralqqs
tlktwggkeenvkkaqeaflvrckanseatlgaykgd

SCOPe Domain Coordinates for d6rnga_:

Click to download the PDB-style file with coordinates for d6rnga_.
(The format of our PDB-style files is described here.)

Timeline for d6rnga_: