SCOPe 2.08: Domain d6mqtg_: 6mqt G:

Lineage for d6mqtg_ (6mqt G:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (160 PDB entries)
   Uniprot Q6P716

8. Domain d6mqtg_: 6mqt G: [383754]
   Other proteins in same PDB: d6mqta2, d6mqtd2, d6mqte2, d6mqtf2
   automated match to d2q21a_
   complexed with gdp, mg

Details for d6mqtg_

PDB Entry: 6mqt, 1.5 Å

PDB Description: hras g12s in complex with gdp

PDB Compounds: (G:) gtpase hras

SCOPe Domain Sequences for d6mqtg_:

Sequence; same for both SEQRES and ATOM records:

>d6mqtg_ c.37.1.8 (G:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgasgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d6mqtg_:

• d6mqtg_ first appeared in SCOPe 2.07