SCOPe 2.05: Domain d1g7kd_: 1g7k D:

Lineage for d1g7kd_ (1g7k D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species)

7. Species Coral (Discosoma sp.) [TaxId:86600] [54516] (3 PDB entries)

8. Domain d1g7kd_: 1g7k D: [38374]

Details for d1g7kd_

PDB Entry: 1g7k, 2 Å

PDB Description: crystal structure of dsred, a red fluorescent protein from discosoma sp. red

PDB Compounds: (D:) fluorescent protein fp583

SCOPe Domain Sequences for d1g7kd_:

Sequence; same for both SEQRES and ATOM records:

>d1g7kd_ d.22.1.1 (D:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.) [TaxId: 86600]}
nvikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqf
qygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfi
gvnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakk
pvqlpgyyyvdsklditshnedytiveqyertegrhhlfl

Timeline for d1g7kd_:

• d1g7kd_ first appeared (with stable ids) in SCOP 1.55
  
• d1g7kd_ appears in SCOPe 2.04
  
• d1g7kd_ appears in SCOPe 2.06
  
• d1g7kd_ appears in the current release, SCOPe 2.08