Lineage for d1g7kd_ (1g7k D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940208Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species)
  7. 2940209Species Coral (Discosoma sp.) [TaxId:86600] [54516] (3 PDB entries)
  8. 2940217Domain d1g7kd_: 1g7k D: [38374]

Details for d1g7kd_

PDB Entry: 1g7k (more details), 2 Å

PDB Description: crystal structure of dsred, a red fluorescent protein from discosoma sp. red
PDB Compounds: (D:) fluorescent protein fp583

SCOPe Domain Sequences for d1g7kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7kd_ d.22.1.1 (D:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.) [TaxId: 86600]}
nvikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqf
qygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfi
gvnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakk
pvqlpgyyyvdsklditshnedytiveqyertegrhhlfl

SCOPe Domain Coordinates for d1g7kd_:

Click to download the PDB-style file with coordinates for d1g7kd_.
(The format of our PDB-style files is described here.)

Timeline for d1g7kd_: